Recombinant Human MMRN1 protein(521-770 aa), C-His-tagged
| Cat.No. : | MMRN1-2847H |
| Product Overview : | Recombinant Human MMRN1 protein(Q13201)(521-770 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 521-770 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME |
| Gene Name | MMRN1 multimerin 1 [ Homo sapiens ] |
| Official Symbol | MMRN1 |
| Synonyms | MMRN1; multimerin 1; MMRN, multimerin; multimerin-1; ECM; EMILIN4; glycoprotein Ia*; GPIa*; EMILIN-4; endothelial cell multimerin; elastin microfibril interfacer 4; elastin microfibril interface located protein 4; MMRN; |
| Gene ID | 22915 |
| mRNA Refseq | NM_007351 |
| Protein Refseq | NP_031377 |
| MIM | 601456 |
| UniProt ID | Q13201 |
| ◆ Recombinant Proteins | ||
| MMRN1-4126H | Recombinant Human MMRN1 Protein (Ala807-Gly1053), His tagged | +Inquiry |
| MMRN1-150H | Recombinant Human MMRN1, His-tagged | +Inquiry |
| MMRN1-2847H | Recombinant Human MMRN1 protein(521-770 aa), C-His-tagged | +Inquiry |
| MMRN1-7952H | Recombinant Human MMRN1 protein, His-tagged | +Inquiry |
| MMRN1-5607M | Recombinant Mouse MMRN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMRN1-4272HCL | Recombinant Human MMRN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMRN1 Products
Required fields are marked with *
My Review for All MMRN1 Products
Required fields are marked with *


