Recombinant Human MMRN1 protein(521-770 aa), C-His-tagged
Cat.No. : | MMRN1-2847H |
Product Overview : | Recombinant Human MMRN1 protein(Q13201)(521-770 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 521-770 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME |
Gene Name | MMRN1 multimerin 1 [ Homo sapiens ] |
Official Symbol | MMRN1 |
Synonyms | MMRN1; multimerin 1; MMRN, multimerin; multimerin-1; ECM; EMILIN4; glycoprotein Ia*; GPIa*; EMILIN-4; endothelial cell multimerin; elastin microfibril interfacer 4; elastin microfibril interface located protein 4; MMRN; |
Gene ID | 22915 |
mRNA Refseq | NM_007351 |
Protein Refseq | NP_031377 |
MIM | 601456 |
UniProt ID | Q13201 |
◆ Recombinant Proteins | ||
MMRN1-9928M | Recombinant Mouse MMRN1 Protein | +Inquiry |
MMRN1-5439H | Recombinant Human MMRN1 Protein, GST-tagged | +Inquiry |
MMRN1-4126H | Recombinant Human MMRN1 Protein (Ala807-Gly1053), His tagged | +Inquiry |
MMRN1-7952H | Recombinant Human MMRN1 protein, His-tagged | +Inquiry |
MMRN1-2847H | Recombinant Human MMRN1 protein(521-770 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMRN1-4272HCL | Recombinant Human MMRN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMRN1 Products
Required fields are marked with *
My Review for All MMRN1 Products
Required fields are marked with *