Recombinant Human MMRN1 protein(521-770 aa), C-His-tagged

Cat.No. : MMRN1-2847H
Product Overview : Recombinant Human MMRN1 protein(Q13201)(521-770 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 521-770 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME
Gene Name MMRN1 multimerin 1 [ Homo sapiens ]
Official Symbol MMRN1
Synonyms MMRN1; multimerin 1; MMRN, multimerin; multimerin-1; ECM; EMILIN4; glycoprotein Ia*; GPIa*; EMILIN-4; endothelial cell multimerin; elastin microfibril interfacer 4; elastin microfibril interface located protein 4; MMRN;
Gene ID 22915
mRNA Refseq NM_007351
Protein Refseq NP_031377
MIM 601456
UniProt ID Q13201

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMRN1 Products

Required fields are marked with *

My Review for All MMRN1 Products

Required fields are marked with *

0
cart-icon