Recombinant Human MMRN1 Protein, GST-tagged
Cat.No. : | MMRN1-5439H |
Product Overview : | Human MMRN1 partial ORF ( NP_031377, 291 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMRN1 multimerin 1 [ Homo sapiens ] |
Official Symbol | MMRN1 |
Synonyms | MMRN1; multimerin 1; MMRN, multimerin; multimerin-1; ECM; EMILIN4; glycoprotein Ia*; GPIa*; EMILIN-4; endothelial cell multimerin; elastin microfibril interfacer 4; elastin microfibril interface located protein 4; MMRN; |
Gene ID | 22915 |
mRNA Refseq | NM_007351 |
Protein Refseq | NP_031377 |
MIM | 601456 |
UniProt ID | Q13201 |
◆ Recombinant Proteins | ||
Mmrn1-7953R | Recombinant Rat Mmrn1 protein, His-tagged | +Inquiry |
MMRN1-5607M | Recombinant Mouse MMRN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMRN1-7952H | Recombinant Human MMRN1 protein, His-tagged | +Inquiry |
MMRN1-2847H | Recombinant Human MMRN1 protein(521-770 aa), C-His-tagged | +Inquiry |
MMRN1-4126H | Recombinant Human MMRN1 Protein (Ala807-Gly1053), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMRN1-4272HCL | Recombinant Human MMRN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMRN1 Products
Required fields are marked with *
My Review for All MMRN1 Products
Required fields are marked with *