"MMRN1" Related Products

Expand

Recombinant Human MMRN1 Protein, GST-tagged

Cat.No. : MMRN1-5439H
Product Overview : Human MMRN1 partial ORF ( NP_031377, 291 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : MMRN1 multimerin 1 [ Homo sapiens ]
Official Symbol : MMRN1
Synonyms : MMRN1; multimerin 1; MMRN, multimerin; multimerin-1; ECM; EMILIN4; glycoprotein Ia*; GPIa*; EMILIN-4; endothelial cell multimerin; elastin microfibril interfacer 4; elastin microfibril interface located protein 4; MMRN;
Gene ID : 22915
mRNA Refseq : NM_007351
Protein Refseq : NP_031377
MIM : 601456
UniProt ID : Q13201

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.