Recombinant Human MOB1A Protein, GST-tagged

Cat.No. : MOB1A-5455H
Product Overview : Human MOBKL1B full-length ORF ( AAH03398.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Molecular Mass : 51.5 kDa
AA Sequence : MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOB1A MOB kinase activator 1A [ Homo sapiens (human) ]
Official Symbol MOB1A
Synonyms MOB1A; MOB kinase activator 1A; MOB1; MATS1; Mob4B; C2orf6; MOBK1B; MOBKL1B; MOB kinase activator 1A; MOB1 Mps One Binder homolog A; MOB1, Mps One Binder kinase activator-like 1B; mob1 alpha; mob1 homolog 1B; mps one binder kinase activator-like 1B
Gene ID 55233
mRNA Refseq NM_001317110
Protein Refseq NP_001304039
MIM 609281
UniProt ID Q9H8S9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOB1A Products

Required fields are marked with *

My Review for All MOB1A Products

Required fields are marked with *

0
cart-icon