Recombinant Human MOB1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MOB1A-5869H |
Product Overview : | MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MOB1A MOB kinase activator 1A [ Homo sapiens (human) ] |
Official Symbol | MOB1A |
Synonyms | MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6, MOB1 Mps One Binder homolog A (yeast), MOB1, Mps One Binder kinase activator like 1B (yeast), MOBK1B, MOBKL1B; FLJ10788; FLJ11595; Mats1; MOB1; Mob4B; mob1 alpha; mob1 homolog 1B; MOB1 Mps One Binder homolog A; mps one binder kinase activator-like 1B; MOB1, Mps One Binder kinase activator-like 1B; MATS1; C2orf6; MOBK1B; MOBKL1B; |
Gene ID | 55233 |
mRNA Refseq | NM_018221 |
Protein Refseq | NP_060691 |
MIM | 609281 |
UniProt ID | Q9H8S9 |
◆ Recombinant Proteins | ||
MOB1A-10283Z | Recombinant Zebrafish MOB1A | +Inquiry |
MOB1A-3381R | Recombinant Rat MOB1A Protein, His (Fc)-Avi-tagged | +Inquiry |
MOB1A-5869H | Recombinant Human MOB1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MOB1A-28178TH | Recombinant Human MOB1A | +Inquiry |
MOB1A-28177TH | Recombinant Human MOB1A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOB1A-413HCL | Recombinant Human MOB1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOB1A Products
Required fields are marked with *
My Review for All MOB1A Products
Required fields are marked with *
0
Inquiry Basket