Recombinant Human MOB1A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MOB1A-5869H
Product Overview : MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 24.9 kDa
AA Sequence : MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MOB1A MOB kinase activator 1A [ Homo sapiens (human) ]
Official Symbol MOB1A
Synonyms MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6, MOB1 Mps One Binder homolog A (yeast), MOB1, Mps One Binder kinase activator like 1B (yeast), MOBK1B, MOBKL1B; FLJ10788; FLJ11595; Mats1; MOB1; Mob4B; mob1 alpha; mob1 homolog 1B; MOB1 Mps One Binder homolog A; mps one binder kinase activator-like 1B; MOB1, Mps One Binder kinase activator-like 1B; MATS1; C2orf6; MOBK1B; MOBKL1B;
Gene ID 55233
mRNA Refseq NM_018221
Protein Refseq NP_060691
MIM 609281
UniProt ID Q9H8S9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOB1A Products

Required fields are marked with *

My Review for All MOB1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon