Recombinant Human MOB3B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MOB3B-1296H |
| Product Overview : | MOBKL2B MS Standard C13 and N15-labeled recombinant protein (NP_079037) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MOB3B MOB kinase activator 3B [ Homo sapiens (human) ] |
| Official Symbol | MOB3B |
| Synonyms | MOB3B; MOB kinase activator 3B; MOB1, Mps One Binder kinase activator like 2B (yeast), MOBKL2B; FLJ13204; MOB1D; monopolar spindle 1 binding; MOB1; domain containing; mob1 homolog 2b; mps one binder kinase activator-like 2B; MOB1, Mps One Binder kinase activator-like 2B; monopolar spindle 1 binding, MOB1, domain containing; MOBKL2B; FLJ23916; MGC32960; |
| Gene ID | 79817 |
| mRNA Refseq | NM_024761 |
| Protein Refseq | NP_079037 |
| MIM | 617652 |
| UniProt ID | Q86TA1 |
| ◆ Recombinant Proteins | ||
| Mob3b-4107M | Recombinant Mouse Mob3b Protein, Myc/DDK-tagged | +Inquiry |
| MOB3B-2620R | Recombinant Rhesus Macaque MOB3B Protein, His (Fc)-Avi-tagged | +Inquiry |
| MOB3B-5030H | Recombinant Human MOB3B, His-tagged | +Inquiry |
| MOB3B-2800R | Recombinant Rhesus monkey MOB3B Protein, His-tagged | +Inquiry |
| MOB3B-5457H | Recombinant Human MOB3B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB3B Products
Required fields are marked with *
My Review for All MOB3B Products
Required fields are marked with *
