Recombinant Human MOB3B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MOB3B-1296H
• Product Overview: MOBKL2B MS Standard C13 and N15-labeled recombinant protein (NP_079037) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene.
• Molecular Mass: 25.5 kDa
• AA Sequence: MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MOB3B MOB kinase activator 3B [ Homo sapiens (human) ]
• Official Symbol: MOB3B
• Synonyms: MOB3B; MOB kinase activator 3B; MOB1, Mps One Binder kinase activator like 2B (yeast), MOBKL2B; FLJ13204; MOB1D; monopolar spindle 1 binding; MOB1; domain containing; mob1 homolog 2b; mps one binder kinase activator-like 2B; MOB1, Mps One Binder kinase activator-like 2B; monopolar spindle 1 binding, MOB1, domain containing; MOBKL2B; FLJ23916; MGC32960
• Gene ID: 79817
• mRNA Refseq: NM_024761
• Protein Refseq: NP_079037
• MIM: 617652
• UniProt ID: Q86TA1