Recombinant Human MOCS2 protein, GST-tagged

Cat.No. : MOCS2-3238H
Product Overview : Recombinant Human MOCS2 protein(O96007)(1-188aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-188aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 47.9 kDa
AA Sequence : MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MOCS2 molybdenum cofactor synthesis 2 [ Homo sapiens ]
Official Symbol MOCS2
Synonyms MOCS2; molybdenum cofactor synthesis 2; molybdopterin synthase catalytic subunit; MOCO1; MOCO1-A; MOCO1-B; MPT synthase large subunit; sulfur carrier protein MOCS2A; molybdopterin-synthase large subunit; molybdopterin-synthase small subunit; molybdenum cofactor synthesis protein 2A; molybdenum cofactor synthesis protein 2B; molybdenum cofactor biosynthesis protein E; molybdopterin synthase sulfur carrier subunit; molybdenum cofactor synthesis protein 2 large subunit; molybdenum cofactor synthesis protein 2 small subunit; MPTS; MCBPE; MOCS2A; MOCS2B;
Gene ID 4338
mRNA Refseq NM_004531
Protein Refseq NP_004522
MIM 603708
UniProt ID O96007

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOCS2 Products

Required fields are marked with *

My Review for All MOCS2 Products

Required fields are marked with *

0
cart-icon