Recombinant Human MOCS2 protein, GST-tagged
Cat.No. : | MOCS2-3238H |
Product Overview : | Recombinant Human MOCS2 protein(O96007)(1-188aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-188aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MOCS2 molybdenum cofactor synthesis 2 [ Homo sapiens ] |
Official Symbol | MOCS2 |
Synonyms | MOCS2; molybdenum cofactor synthesis 2; molybdopterin synthase catalytic subunit; MOCO1; MOCO1-A; MOCO1-B; MPT synthase large subunit; sulfur carrier protein MOCS2A; molybdopterin-synthase large subunit; molybdopterin-synthase small subunit; molybdenum cofactor synthesis protein 2A; molybdenum cofactor synthesis protein 2B; molybdenum cofactor biosynthesis protein E; molybdopterin synthase sulfur carrier subunit; molybdenum cofactor synthesis protein 2 large subunit; molybdenum cofactor synthesis protein 2 small subunit; MPTS; MCBPE; MOCS2A; MOCS2B; |
Gene ID | 4338 |
mRNA Refseq | NM_004531 |
Protein Refseq | NP_004522 |
MIM | 603708 |
UniProt ID | O96007 |
◆ Recombinant Proteins | ||
MOCS2-3726R | Recombinant Rat MOCS2 Protein | +Inquiry |
MOCS2-7145H | Recombinant Human Molybdenum Cofactor Synthesis 2, His-tagged | +Inquiry |
Mocs2-1789M | Recombinant Mouse Mocs2 Protein, His-tagged | +Inquiry |
MOCS2-9949M | Recombinant Mouse MOCS2 Protein | +Inquiry |
MOCS2-3384R | Recombinant Rat MOCS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOCS2-4260HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
MOCS2-4261HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOCS2 Products
Required fields are marked with *
My Review for All MOCS2 Products
Required fields are marked with *