Recombinant Human MOCS3, His-tagged
Cat.No. : | MOCS3-143H |
Product Overview : | Recombinant Human Adenylyltransferase and Sulfurtransferase MOCS3/MOCS3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Tyr460) of Human MOCS3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-460 a.a. |
Description : | Adenylyltransferase and Sulfurtransferase MOCS3 (MOCS3) is a member of the hesA/moeB/thiF family. MOCS3 contains one Molybdopterin-synthase adenylyltransferase domain and one Molybdopterin-synthase sulfurtransferase domain. MOCS3 plays an important role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln), MOCS3 is essential for biosynthesis of the molybdenum cofactor. MOCS3 can interact with NFS1, which may act as a sulfur donor for thiocarboxylation reactions. |
AA Sequence : | MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSR QLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGE ALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVL AGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEV LKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCR SLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLK EAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDG TFPQYVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MOCS3 molybdenum cofactor synthesis 3 [ Homo sapiens ] |
Official Symbol | MOCS3 |
Synonyms | MOCS3; molybdenum cofactor synthesis 3; adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; UBA4; ubiquitin activating enzyme E1 homolog (yeast); ubiquitin like modifier activating enzyme 4; MPT synthase sulfurylase; molybdopterin synthase sulfurylase; molybdenum cofactor synthesis protein 3; ubiquitin-like modifier activating enzyme 4; UBA4, ubiquitin-activating enzyme E1 homolog; MGC9252; |
Gene ID | 27304 |
mRNA Refseq | NM_014484 |
Protein Refseq | NP_055299 |
MIM | 609277 |
UniProt ID | O95396 |
Chromosome Location | 20q13.13 |
Pathway | Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Molybdenum cofactor biosynthesis, organism-specific biosystem; Sulfur relay system, organism-specific biosystem; Sulfur relay system, conserved biosystem; molybdenum cofactor biosynthesis, conserved biosystem; |
Function | ATP binding; URM1 activating enzyme activity; metal ion binding; nucleotide binding; nucleotidyltransferase activity; protein binding; sulfurtransferase activity; sulfurtransferase activity; thiosulfate sulfurtransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
MOCS3-6301HF | Recombinant Full Length Human MOCS3 Protein, GST-tagged | +Inquiry |
MOCS3-143H | Recombinant Human MOCS3, His-tagged | +Inquiry |
Mocs3-3194M | Recombinant Mouse Mocs3, His-tagged | +Inquiry |
MOCS3-9950M | Recombinant Mouse MOCS3 Protein | +Inquiry |
MOCS3-585H | Recombinant Human MOCS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOCS3-4259HCL | Recombinant Human MOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOCS3 Products
Required fields are marked with *
My Review for All MOCS3 Products
Required fields are marked with *