Recombinant Human MOCS3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MOCS3-585H |
| Product Overview : | MOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_055299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. |
| Molecular Mass : | 49.5 kDa |
| AA Sequence : | MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MOCS3 molybdenum cofactor synthesis 3 [ Homo sapiens (human) ] |
| Official Symbol | MOCS3 |
| Synonyms | MOCS3; molybdenum cofactor synthesis 3; adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; UBA4; ubiquitin activating enzyme E1 homolog (yeast); ubiquitin like modifier activating enzyme 4; MPT synthase sulfurylase; molybdopterin synthase sulfurylase; molybdenum cofactor synthesis protein 3; ubiquitin-like modifier activating enzyme 4; UBA4, ubiquitin-activating enzyme E1 homolog; MGC9252; |
| Gene ID | 27304 |
| mRNA Refseq | NM_014484 |
| Protein Refseq | NP_055299 |
| MIM | 609277 |
| UniProt ID | O95396 |
| ◆ Recombinant Proteins | ||
| MOCS3-6301HF | Recombinant Full Length Human MOCS3 Protein, GST-tagged | +Inquiry |
| MOCS3-5465H | Recombinant Human MOCS3 Protein, GST-tagged | +Inquiry |
| MOCS3-10478Z | Recombinant Zebrafish MOCS3 | +Inquiry |
| MOCS3-143H | Recombinant Human MOCS3, His-tagged | +Inquiry |
| Mocs3-4110M | Recombinant Mouse Mocs3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOCS3-4259HCL | Recombinant Human MOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOCS3 Products
Required fields are marked with *
My Review for All MOCS3 Products
Required fields are marked with *
