Recombinant Human MOG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MOG-3593H |
Product Overview : | MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MOG myelin oligodendrocyte glycoprotein [ Homo sapiens (human) ] |
Official Symbol | MOG |
Synonyms | MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137; |
Gene ID | 4340 |
mRNA Refseq | NM_206809 |
Protein Refseq | NP_996532 |
MIM | 159465 |
UniProt ID | Q16653 |
◆ Recombinant Proteins | ||
RFL34853PF | Recombinant Full Length Pongo Abelii Myelin-Oligodendrocyte Glycoprotein(Mog) Protein, His-Tagged | +Inquiry |
MOG-5453H | Recombinant Human MOG Protein, MYC/DDK-tagged | +Inquiry |
MOG-4585H | Recombinant Human MOG Protein (Gly30-Tyr149), His tagged | +Inquiry |
Mog-4111M | Recombinant Mouse Mog Protein, Myc/DDK-tagged | +Inquiry |
MOG-060H | Active Recombinant Human MOG Protein | +Inquiry |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOG Products
Required fields are marked with *
My Review for All MOG Products
Required fields are marked with *
0
Inquiry Basket