Recombinant Human MOG Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MOG-3593H
• Product Overview: MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Mass: 25.1 kDa
• AA Sequence: MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MOG myelin oligodendrocyte glycoprotein [ Homo sapiens (human) ]
• Official Symbol: MOG
• Synonyms: MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137
• Gene ID: 4340
• mRNA Refseq: NM_206809
• Protein Refseq: NP_996532
• MIM: 159465
• UniProt ID: Q16653