Recombinant Human MOG Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MOG-3593H
Product Overview : MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Mass : 25.1 kDa
AA Sequence : MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MOG myelin oligodendrocyte glycoprotein [ Homo sapiens (human) ]
Official Symbol MOG
Synonyms MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137;
Gene ID 4340
mRNA Refseq NM_206809
Protein Refseq NP_996532
MIM 159465
UniProt ID Q16653

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOG Products

Required fields are marked with *

My Review for All MOG Products

Required fields are marked with *

0
cart-icon