Recombinant Human MORC3 Protein, His-SUMO-tagged

• Cat.No.: MORC3-1284H
• Product Overview: Recombinant Human MORC3 Protein (1-290aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-290 a.a.
• Description: This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 48.7 kDa
• AA Sequence: MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: MORC3 MORC family CW-type zinc finger 3 [ Homo sapiens (human) ]
• Official Symbol: MORC3
• Synonyms: NXP2; ZCW5; ZCWCC3; nuclear matrix protein 2; nuclear matrix protein NXP2; zinc finger CW-type coiled-coil domain protein 3; zinc finger, CW type with coiled-coil domain 3
• Gene ID: 23515
• mRNA Refseq: NM_015358.2
• Protein Refseq: NP_056173.1
• MIM: 610078
• UniProt ID: Q14149