Recombinant Human MORC3 Protein, His-SUMO-tagged

Cat.No. : MORC3-1284H
Product Overview : Recombinant Human MORC3 Protein (1-290aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-290 a.a.
Description : This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 48.7 kDa
AA Sequence : MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name MORC3 MORC family CW-type zinc finger 3 [ Homo sapiens (human) ]
Official Symbol MORC3
Synonyms NXP2; ZCW5; ZCWCC3; nuclear matrix protein 2; nuclear matrix protein NXP2; zinc finger CW-type coiled-coil domain protein 3; zinc finger, CW type with coiled-coil domain 3
Gene ID 23515
mRNA Refseq NM_015358.2
Protein Refseq NP_056173.1
MIM 610078
UniProt ID Q14149

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MORC3 Products

Required fields are marked with *

My Review for All MORC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon