Recombinant Human MORF4L1 Protein, GST-tagged

Cat.No. : MORF4L1-5477H
Product Overview : Human MORF4L1 full-length ORF ( AAH22845, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MORF4L1 (Mortality Factor 4 Like 1) is a Protein Coding gene. Diseases associated with MORF4L1 include Paraneoplastic Cerebellar Degeneration. Among its related pathways are Chromatin organization and Chromatin Regulation / Acetylation. GO annotations related to this gene include chromatin binding and protein N-terminus binding. An important paralog of this gene is MORF4L2.
Molecular Mass : 61.27 kDa
AA Sequence : MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MORF4L1 mortality factor 4 like 1 [ Homo sapiens ]
Official Symbol MORF4L1
Synonyms MORF4L1; mortality factor 4 like 1; mortality factor 4-like protein 1; Eaf3; Esa1p associated factor 3 homolog (S. cerevisiae); HsT17725; MEAF3; MORF related gene on chromosome 15; MORFRG15; MRG15; protein MSL3-1; MORF-related gene 15 protein; Esa1p-associated factor 3 homolog; MORF-related gene on chromosome 15; transcription factor-like protein MRG15; FWP006; S863-6; MGC10631;
Gene ID 10933
mRNA Refseq NM_006791
Protein Refseq NP_006782
MIM 607303
UniProt ID Q9UBU8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MORF4L1 Products

Required fields are marked with *

My Review for All MORF4L1 Products

Required fields are marked with *

0
cart-icon