Recombinant Human MORN4 Protein, GST-tagged

• Cat.No.: MORN4-5483H
• Product Overview: Human MORN4 full-length ORF ( NP_849154.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MORN4 (MORN Repeat Containing 4) is a Protein Coding gene.
• Molecular Mass: 42.6 kDa
• AA Sequence: MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MORN4 MORN repeat containing 4 [ Homo sapiens ]
• Official Symbol: MORN4
• Synonyms: MORN4; MORN repeat containing 4; C10orf83, chromosome 10 open reading frame 83; MORN repeat-containing protein 4; 44050 protein; bA548K23.4; FLJ25925; retinophilin; protein 44050; C10orf83; RP11-548K23.4
• Gene ID: 118812
• mRNA Refseq: NM_001098831
• Protein Refseq: NP_001092301
• UniProt ID: Q8NDC4