Recombinant Human MORN4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MORN4-1035H | 
| Product Overview : | MORN4 MS Standard C13 and N15-labeled recombinant protein (NP_849154) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | MORN4 (MORN Repeat Containing 4) is a Protein Coding gene. Diseases associated with MORN4 include Deafness, Autosomal Recessive 30. | 
| Molecular Mass : | 16.2 kDa | 
| AA Sequence : | MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTATRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | MORN4 MORN repeat containing 4 [ Homo sapiens (human) ] | 
| Official Symbol | MORN4 | 
| Synonyms | MORN4; MORN repeat containing 4; C10orf83, chromosome 10 open reading frame 83; MORN repeat-containing protein 4; 44050 protein; bA548K23.4; FLJ25925; retinophilin; protein 44050; C10orf83; RP11-548K23.4; | 
| Gene ID | 118812 | 
| mRNA Refseq | NM_178832 | 
| Protein Refseq | NP_849154 | 
| MIM | 617736 | 
| UniProt ID | Q8NDC4 | 
| ◆ Recombinant Proteins | ||
| MORN4-6313HF | Recombinant Full Length Human MORN4 Protein, GST-tagged | +Inquiry | 
| MORN4-9967M | Recombinant Mouse MORN4 Protein | +Inquiry | 
| MORN4-5483H | Recombinant Human MORN4 Protein, GST-tagged | +Inquiry | 
| MORN4-1035H | Recombinant Human MORN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| Morn4-4118M | Recombinant Mouse Morn4 Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MORN4-4249HCL | Recombinant Human MORN4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MORN4 Products
Required fields are marked with *
My Review for All MORN4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            