Recombinant Human MORN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MORN4-1035H
Product Overview : MORN4 MS Standard C13 and N15-labeled recombinant protein (NP_849154) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MORN4 (MORN Repeat Containing 4) is a Protein Coding gene. Diseases associated with MORN4 include Deafness, Autosomal Recessive 30.
Molecular Mass : 16.2 kDa
AA Sequence : MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MORN4 MORN repeat containing 4 [ Homo sapiens (human) ]
Official Symbol MORN4
Synonyms MORN4; MORN repeat containing 4; C10orf83, chromosome 10 open reading frame 83; MORN repeat-containing protein 4; 44050 protein; bA548K23.4; FLJ25925; retinophilin; protein 44050; C10orf83; RP11-548K23.4;
Gene ID 118812
mRNA Refseq NM_178832
Protein Refseq NP_849154
MIM 617736
UniProt ID Q8NDC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MORN4 Products

Required fields are marked with *

My Review for All MORN4 Products

Required fields are marked with *

0
cart-icon
0
compare icon