Recombinant Human MORN4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MORN4-1035H |
Product Overview : | MORN4 MS Standard C13 and N15-labeled recombinant protein (NP_849154) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MORN4 (MORN Repeat Containing 4) is a Protein Coding gene. Diseases associated with MORN4 include Deafness, Autosomal Recessive 30. |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MORN4 MORN repeat containing 4 [ Homo sapiens (human) ] |
Official Symbol | MORN4 |
Synonyms | MORN4; MORN repeat containing 4; C10orf83, chromosome 10 open reading frame 83; MORN repeat-containing protein 4; 44050 protein; bA548K23.4; FLJ25925; retinophilin; protein 44050; C10orf83; RP11-548K23.4; |
Gene ID | 118812 |
mRNA Refseq | NM_178832 |
Protein Refseq | NP_849154 |
MIM | 617736 |
UniProt ID | Q8NDC4 |
◆ Recombinant Proteins | ||
MORN4-6313HF | Recombinant Full Length Human MORN4 Protein, GST-tagged | +Inquiry |
MORN4-9967M | Recombinant Mouse MORN4 Protein | +Inquiry |
MORN4-5483H | Recombinant Human MORN4 Protein, GST-tagged | +Inquiry |
MORN4-1035H | Recombinant Human MORN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Morn4-4118M | Recombinant Mouse Morn4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MORN4-4249HCL | Recombinant Human MORN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MORN4 Products
Required fields are marked with *
My Review for All MORN4 Products
Required fields are marked with *