Recombinant Human MORN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MORN4-1035H
• Product Overview: MORN4 MS Standard C13 and N15-labeled recombinant protein (NP_849154) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: MORN4 (MORN Repeat Containing 4) is a Protein Coding gene. Diseases associated with MORN4 include Deafness, Autosomal Recessive 30.
• Molecular Mass: 16.2 kDa
• AA Sequence: MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MORN4 MORN repeat containing 4 [ Homo sapiens (human) ]
• Official Symbol: MORN4
• Synonyms: MORN4; MORN repeat containing 4; C10orf83, chromosome 10 open reading frame 83; MORN repeat-containing protein 4; 44050 protein; bA548K23.4; FLJ25925; retinophilin; protein 44050; C10orf83; RP11-548K23.4
• Gene ID: 118812
• mRNA Refseq: NM_178832
• Protein Refseq: NP_849154
• MIM: 617736
• UniProt ID: Q8NDC4