Recombinant Human MORN5 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MORN5-4299H |
| Product Overview : | MORN5 MS Standard C13 and N15-labeled recombinant protein (NP_940871) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | MORN5 (MORN Repeat Containing 5) is a Protein Coding gene. |
| Molecular Mass : | 18.7 kDa |
| AA Sequence : | MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MORN5 MORN repeat containing 5 [ Homo sapiens (human) ] |
| Official Symbol | MORN5 |
| Synonyms | MORN5; MORN repeat containing 5; C9orf18; C9orf113; MORN repeat-containing protein 5 |
| Gene ID | 254956 |
| mRNA Refseq | NM_198469 |
| Protein Refseq | NP_940871 |
| UniProt ID | Q5VZ52 |
| ◆ Recombinant Proteins | ||
| MORN5-3015Z | Recombinant Zebrafish MORN5 | +Inquiry |
| MORN5-1635H | Recombinant Human MORN5 | +Inquiry |
| Morn5-4119M | Recombinant Mouse Morn5 Protein, Myc/DDK-tagged | +Inquiry |
| MORN5-3496H | Recombinant Human MORN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MORN5-4299H | Recombinant Human MORN5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MORN5-4248HCL | Recombinant Human MORN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MORN5 Products
Required fields are marked with *
My Review for All MORN5 Products
Required fields are marked with *




