Recombinant Human MORN5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MORN5-4299H
Product Overview : MORN5 MS Standard C13 and N15-labeled recombinant protein (NP_940871) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MORN5 (MORN Repeat Containing 5) is a Protein Coding gene.
Molecular Mass : 18.7 kDa
AA Sequence : MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MORN5 MORN repeat containing 5 [ Homo sapiens (human) ]
Official Symbol MORN5
Synonyms MORN5; MORN repeat containing 5; C9orf18; C9orf113; MORN repeat-containing protein 5
Gene ID 254956
mRNA Refseq NM_198469
Protein Refseq NP_940871
UniProt ID Q5VZ52

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MORN5 Products

Required fields are marked with *

My Review for All MORN5 Products

Required fields are marked with *

0
cart-icon
0
compare icon