Recombinant Human MOS Protein, GST-tagged
| Cat.No. : | MOS-5485H |
| Product Overview : | Human MOS full-length ORF ( NP_005363.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM |
| Molecular Mass : | 64.2 kDa |
| AA Sequence : | MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MOS v-mos Moloney murine sarcoma viral oncogene homolog [ Homo sapiens ] |
| Official Symbol | MOS |
| Synonyms | MOS; v-mos Moloney murine sarcoma viral oncogene homolog; proto-oncogene serine/threonine-protein kinase mos; c-mos; proto-oncogene c-Mos; oocyte maturation factor mos; oncogene MOS, Moloney murine sarcoma virus; MSV; MGC119962; MGC119963; |
| Gene ID | 4342 |
| mRNA Refseq | NM_005372 |
| Protein Refseq | NP_005363 |
| MIM | 190060 |
| UniProt ID | P00540 |
| ◆ Recombinant Proteins | ||
| MOS-3161C | Recombinant Chicken MOS | +Inquiry |
| MOS-5485H | Recombinant Human MOS Protein, GST-tagged | +Inquiry |
| MOS-6314HF | Recombinant Full Length Human MOS Protein, GST-tagged | +Inquiry |
| MOS-11620Z | Recombinant Zebrafish MOS | +Inquiry |
| MOS-6055HF | Active Recombinant Full Length Human MOS Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOS-4247HCL | Recombinant Human MOS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOS Products
Required fields are marked with *
My Review for All MOS Products
Required fields are marked with *
