Recombinant Human MOSC1 Protein, His-tagged
Cat.No. : | MOSC1-36H |
Product Overview : | Recombinant Human MOSC1 Protein(NP_073583.3)(Arg41~Leu335) is expressed from E. coli with a His Tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Arg41~Leu335 |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT,0.01% SKL, 5% Trehalose and Proclin300. |
Molecular Mass : | 37kDa(Analysis of differences refer to the manual) |
AA Sequence : | RRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLL |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 97% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. (May be suitable for use in other assays to be determined by the end user.) |
Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80ºC for 12 months. |
Concentration : | 200µg/mL |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | MTARC1 |
Official Symbol | MTARC1 |
Synonyms | Molybdenum Cofactor Sulphurase C-Terminal Domain Containing Protein; Mitochondrial amidoxime-reducing component 1 |
Gene ID | 64757 |
mRNA Refseq | NM_022746.4 |
Protein Refseq | NP_073583.3 |
MIM | 614126 |
UniProt ID | Q5VT66 |
◆ Recombinant Proteins | ||
MOSC1-36H | Recombinant Human MOSC1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOSC1 Products
Required fields are marked with *
My Review for All MOSC1 Products
Required fields are marked with *
0
Inquiry Basket