Recombinant Human MOSC1 Protein, His-tagged

Cat.No. : MOSC1-36H
Product Overview : Recombinant Human MOSC1 Protein(NP_073583.3)(Arg41~Leu335) is expressed from E. coli with a His Tag at the N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Arg41~Leu335
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT,0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 37kDa(Analysis of differences refer to the manual)
AA Sequence : RRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLL
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 97%
Applications : Positive Control; Immunogen; SDS-PAGE; WB. (May be suitable for use in other assays to be determined by the end user.)
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles.
Store at 2-8°C for one month.
Aliquot and store at -80ºC for 12 months.
Concentration : 200µg/mL
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name MTARC1
Official Symbol MTARC1
Synonyms Molybdenum Cofactor Sulphurase C-Terminal Domain Containing Protein; Mitochondrial amidoxime-reducing component 1
Gene ID 64757
mRNA Refseq NM_022746.4
Protein Refseq NP_073583.3
MIM 614126
UniProt ID Q5VT66

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOSC1 Products

Required fields are marked with *

My Review for All MOSC1 Products

Required fields are marked with *

0
cart-icon