Recombinant Human MOV10L1 Protein, GST-tagged

Cat.No. : MOV10L1-5491H
Product Overview : Human MOV10L1 partial ORF ( NP_061868, 436 a.a. - 545 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : FLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOV10L1 Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse) [ Homo sapiens ]
Official Symbol MOV10L1
Synonyms CHAMP; DJ402G11.8
Gene ID 54456
mRNA Refseq NM_018995
Protein Refseq NP_061868
MIM 605794
UniProt ID Q9BXT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOV10L1 Products

Required fields are marked with *

My Review for All MOV10L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon