Recombinant Human MOV10L1 Protein, GST-tagged
| Cat.No. : | MOV10L1-5491H |
| Product Overview : | Human MOV10L1 partial ORF ( NP_061868, 436 a.a. - 545 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | FLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MOV10L1 Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse) [ Homo sapiens ] |
| Official Symbol | MOV10L1 |
| Synonyms | CHAMP; DJ402G11.8 |
| Gene ID | 54456 |
| mRNA Refseq | NM_018995 |
| Protein Refseq | NP_061868 |
| MIM | 605794 |
| UniProt ID | Q9BXT6 |
| ◆ Recombinant Proteins | ||
| MOV10L1-5491H | Recombinant Human MOV10L1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOV10L1 Products
Required fields are marked with *
My Review for All MOV10L1 Products
Required fields are marked with *
