Recombinant Human MPHOSPH6 Protein, GST-tagged
Cat.No. : | MPHOSPH6-5499H |
Product Overview : | Human MPHOSPH6 full-length ORF ( AAH05242, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MPHOSPH6 (M-Phase Phosphoprotein 6) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and rRNA processing in the nucleus and cytosol. GO annotations related to this gene include RNA binding. |
Molecular Mass : | 43.34 kDa |
AA Sequence : | MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPHOSPH6 M-phase phosphoprotein 6 [ Homo sapiens ] |
Official Symbol | MPHOSPH6 |
Synonyms | MPHOSPH6; M-phase phosphoprotein 6; MPP6; MPP; MPP-6; |
Gene ID | 10200 |
mRNA Refseq | NM_005792 |
Protein Refseq | NP_005783 |
MIM | 605500 |
UniProt ID | Q99547 |
◆ Recombinant Proteins | ||
MPHOSPH6-138H | Recombinant Human MPHOSPH6 protein, T7-tagged | +Inquiry |
MPHOSPH6-4735C | Recombinant Chicken MPHOSPH6 | +Inquiry |
MPHOSPH6-2633R | Recombinant Rhesus Macaque MPHOSPH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPHOSPH6-5499H | Recombinant Human MPHOSPH6 Protein, GST-tagged | +Inquiry |
MPHOSPH6-1044Z | Recombinant Zebrafish MPHOSPH6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPHOSPH6-4238HCL | Recombinant Human MPHOSPH6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPHOSPH6 Products
Required fields are marked with *
My Review for All MPHOSPH6 Products
Required fields are marked with *