Recombinant Human MPHOSPH6 Protein, GST-tagged

Cat.No. : MPHOSPH6-5499H
Product Overview : Human MPHOSPH6 full-length ORF ( AAH05242, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MPHOSPH6 (M-Phase Phosphoprotein 6) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and rRNA processing in the nucleus and cytosol. GO annotations related to this gene include RNA binding.
Molecular Mass : 43.34 kDa
AA Sequence : MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPHOSPH6 M-phase phosphoprotein 6 [ Homo sapiens ]
Official Symbol MPHOSPH6
Synonyms MPHOSPH6; M-phase phosphoprotein 6; MPP6; MPP; MPP-6;
Gene ID 10200
mRNA Refseq NM_005792
Protein Refseq NP_005783
MIM 605500
UniProt ID Q99547

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPHOSPH6 Products

Required fields are marked with *

My Review for All MPHOSPH6 Products

Required fields are marked with *

0
cart-icon
0
compare icon