"MPHOSPH6" Related Products

Expand

Recombinant Human MPHOSPH6 protein, T7-tagged

Cat.No.: MPHOSPH6-138H
Product Overview: Recombinant human MPHOSPH6 (160aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIE EQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDH ANYEEDENGDITPIKAKKMFLKPQD
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: MPHOSPH6 M-phase phosphoprotein 6 [ Homo sapiens ]
Official Symbol: MPHOSPH6
Synonyms: MPHOSPH6; M-phase phosphoprotein 6; MPP6; MPP; MPP-6;
Gene ID: 10200
mRNA Refseq: NM_005792
Protein Refseq: NP_005783
MIM: 605500
UniProt ID: Q99547
Chromosome Location: 16q23.3
Pathway: RNA degradation, organism-specific biosystem; RNA degradation, conserved biosystem;
Function: RNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.