Recombinant Human MPHOSPH6 protein, T7-tagged
Cat.No. : | MPHOSPH6-138H |
Product Overview : | Recombinant human MPHOSPH6 (160aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 160 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIE EQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDH ANYEEDENGDITPIKAKKMFLKPQD |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MPHOSPH6 M-phase phosphoprotein 6 [ Homo sapiens ] |
Official Symbol | MPHOSPH6 |
Synonyms | MPHOSPH6; M-phase phosphoprotein 6; MPP6; MPP; MPP-6; |
Gene ID | 10200 |
mRNA Refseq | NM_005792 |
Protein Refseq | NP_005783 |
MIM | 605500 |
UniProt ID | Q99547 |
Chromosome Location | 16q23.3 |
Pathway | RNA degradation, organism-specific biosystem; RNA degradation, conserved biosystem; |
Function | RNA binding; protein binding; |
◆ Recombinant Proteins | ||
MPHOSPH6-138H | Recombinant Human MPHOSPH6 protein, T7-tagged | +Inquiry |
MPHOSPH6-1044Z | Recombinant Zebrafish MPHOSPH6 | +Inquiry |
MPHOSPH6-9984M | Recombinant Mouse MPHOSPH6 Protein | +Inquiry |
MPHOSPH6-6321HF | Recombinant Full Length Human MPHOSPH6 Protein, GST-tagged | +Inquiry |
MPHOSPH6-5499H | Recombinant Human MPHOSPH6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPHOSPH6-4238HCL | Recombinant Human MPHOSPH6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPHOSPH6 Products
Required fields are marked with *
My Review for All MPHOSPH6 Products
Required fields are marked with *
0
Inquiry Basket