Recombinant Human MPI Protein, GST-tagged
| Cat.No. : | MPI-5503H |
| Product Overview : | Human MPI full-length ORF ( NP_002426.1, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib. [provided by RefSeq |
| Molecular Mass : | 73.1 kDa |
| AA Sequence : | MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MPI mannose phosphate isomerase [ Homo sapiens ] |
| Official Symbol | MPI |
| Synonyms | MPI; mannose phosphate isomerase; mannose-6-phosphate isomerase; mannose 6 phosphate isomerase; phosphohexomutase; phosphomannose isomerase 1; mannose-6- phosphate isomerase; PMI; PMI1; CDG1B; FLJ39201; |
| Gene ID | 4351 |
| mRNA Refseq | NM_002435 |
| Protein Refseq | NP_002426 |
| MIM | 154550 |
| UniProt ID | P34949 |
| ◆ Recombinant Proteins | ||
| Mpi-454M | Recombinant Mouse Mpi Protein, MYC/DDK-tagged | +Inquiry |
| MPI-1767HFL | Recombinant Full Length Human MPI Protein, C-Flag-tagged | +Inquiry |
| MPI-5503H | Recombinant Human MPI Protein, GST-tagged | +Inquiry |
| MPI-4591H | Recombinant Human MPI Protein (Ala2-Leu423), N-His tagged | +Inquiry |
| MPI-1426H | Recombinant Human MPI Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPI Products
Required fields are marked with *
My Review for All MPI Products
Required fields are marked with *



