Recombinant Human MPIG6B Protein, GST-Tagged
| Cat.No. : | MPIG6B-0122H |
| Product Overview : | Human MPIG6B full-length ORF (NP_079536.2, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 51.4 kDa |
| AA Sequence : | MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKGGRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MPIG6B megakaryocyte and platelet inhibitory receptor G6b [ Homo sapiens (human) ] |
| Official Symbol | MPIG6B |
| Synonyms | MPIG6B; megakaryocyte and platelet inhibitory receptor G6b; C6ORF25; chromosome 6 open reading frame 25; protein G6b; G6b; NG31; immunoglobulin receptor; MGC142279; MGC142281; |
| Gene ID | 80739 |
| mRNA Refseq | NM_025260 |
| Protein Refseq | NP_079536 |
| MIM | 606520 |
| UniProt ID | O95866 |
| ◆ Recombinant Proteins | ||
| MPIG6B-2705HF | Recombinant Full Length Human MPIG6B Protein, GST-tagged | +Inquiry |
| MPIG6B-0122H | Recombinant Human MPIG6B Protein, GST-Tagged | +Inquiry |
| RFL35064HF | Recombinant Full Length Human Protein G6B(G6B) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPIG6B Products
Required fields are marked with *
My Review for All MPIG6B Products
Required fields are marked with *
