Recombinant Human MPIG6B Protein, GST-Tagged

Cat.No. : MPIG6B-0122H
Product Overview : Human MPIG6B full-length ORF (NP_079536.2, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 51.4 kDa
AA Sequence : MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKGGRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPIG6B megakaryocyte and platelet inhibitory receptor G6b [ Homo sapiens (human) ]
Official Symbol MPIG6B
Synonyms MPIG6B; megakaryocyte and platelet inhibitory receptor G6b; C6ORF25; chromosome 6 open reading frame 25; protein G6b; G6b; NG31; immunoglobulin receptor; MGC142279; MGC142281;
Gene ID 80739
mRNA Refseq NM_025260
Protein Refseq NP_079536
MIM 606520
UniProt ID O95866

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPIG6B Products

Required fields are marked with *

My Review for All MPIG6B Products

Required fields are marked with *

0
cart-icon
0
compare icon