Recombinant Human MPND Protein, GST-tagged
Cat.No. : | MPND-4249H |
Product Overview : | Human FLJ14981 full-length ORF ( NP_116257.2, 1 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MPND (MPN Domain Containing) is a Protein Coding gene. GO annotations related to this gene include peptidase activity. An important paralog of this gene is MYSM1. |
Molecular Mass : | 77.1 kDa |
AA Sequence : | MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYKGSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPND MPN domain containing [ Homo sapiens ] |
Official Symbol | MPND |
Synonyms | MPND; MPN domain containing; MPN domain-containing protein; FLJ14981; |
Gene ID | 84954 |
mRNA Refseq | NM_001159846 |
Protein Refseq | NP_001153318 |
UniProt ID | Q8N594 |
◆ Recombinant Proteins | ||
MPND-4473Z | Recombinant Zebrafish MPND | +Inquiry |
MPND-4249H | Recombinant Human MPND Protein, GST-tagged | +Inquiry |
MPND-0867H | Recombinant Human MPND Protein (M1-S471), GST tagged | +Inquiry |
MPND-0866H | Recombinant Human MPND Protein (M1-S471), Tag Free | +Inquiry |
MPND-4872HF | Recombinant Full Length Human MPND Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPND-633HCL | Recombinant Human MPND cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPND Products
Required fields are marked with *
My Review for All MPND Products
Required fields are marked with *