"MPO" Related Products

Expand

Recombinant Human MPO Protein, GST-tagged

Cat.No. : MPO-5506H
Product Overview : Human MPO partial ORF ( NP_000241, 646 a.a. - 745 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : MPO myeloperoxidase [ Homo sapiens ]
Official Symbol : MPO
Synonyms : MPO; myeloperoxidase;
Gene ID : 4353
mRNA Refseq : NM_000250
Protein Refseq : NP_000241
MIM : 606989
UniProt ID : P05164

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.