Recombinant Human MPO Protein, GST-tagged
Cat.No. : | MPO-5506H |
Product Overview : | Human MPO partial ORF ( NP_000241, 646 a.a. - 745 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPO myeloperoxidase [ Homo sapiens ] |
Official Symbol | MPO |
Synonyms | MPO; myeloperoxidase; |
Gene ID | 4353 |
mRNA Refseq | NM_000250 |
Protein Refseq | NP_000241 |
MIM | 606989 |
UniProt ID | P05164 |
◆ Recombinant Proteins | ||
Mpo-1790R | Recombinant Rat Mpo Protein, His-tagged | +Inquiry |
MPO-4593H | Recombinant Human MPO Protein (Met1-Ser745), C-His tagged | +Inquiry |
MPO-10HFL | Active Recombinant Full Length Human myeloperoxidase Protein, His tagged | +Inquiry |
Mpo-5650M | Recombinant Mouse Mpo Protein, His (Fc)-Avi-tagged | +Inquiry |
MPO-1427H | Recombinant Human MPO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPO-4234HCL | Recombinant Human MPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPO Products
Required fields are marked with *
My Review for All MPO Products
Required fields are marked with *
0
Inquiry Basket