Recombinant Human MPO Protein, GST-tagged
| Cat.No. : | MPO-5506H |
| Product Overview : | Human MPO partial ORF ( NP_000241, 646 a.a. - 745 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MPO myeloperoxidase [ Homo sapiens ] |
| Official Symbol | MPO |
| Synonyms | MPO; myeloperoxidase; |
| Gene ID | 4353 |
| mRNA Refseq | NM_000250 |
| Protein Refseq | NP_000241 |
| MIM | 606989 |
| UniProt ID | P05164 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPO Products
Required fields are marked with *
My Review for All MPO Products
Required fields are marked with *



