Recombinant Human MPP4 Protein, GST-tagged
Cat.No. : | MPP4-5512H |
Product Overview : | Human MPP4 partial ORF ( NP_149055, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) protein family, with an N-terminal PDZ domain, a central src homology 3 region (SH3), and a C-terminal guanylate kinase-like (GUK) domain. The protein is localized to the outer limiting membrane in the retina, and is thought to function in photoreceptor polarity and the organization of specialized intercellular junctions. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPP4 membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4) [ Homo sapiens ] |
Official Symbol | MPP4 |
Synonyms | MPP4; membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4); DLG6; MAGUK p55 subfamily member 4; discs large homolog 6; discs, large homolog 6; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 5 protein; ALS2CR5; |
Gene ID | 58538 |
mRNA Refseq | NM_033066 |
Protein Refseq | NP_149055 |
MIM | 606575 |
UniProt ID | Q96JB8 |
◆ Recombinant Proteins | ||
MPP4-801H | Recombinant Human MPP4 | +Inquiry |
MPP4-5512H | Recombinant Human MPP4 Protein, GST-tagged | +Inquiry |
MPP4-3500H | Recombinant Human MPP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPP4 Products
Required fields are marked with *
My Review for All MPP4 Products
Required fields are marked with *
0
Inquiry Basket