Recombinant Human MPP4 Protein, GST-tagged

Cat.No. : MPP4-5512H
Product Overview : Human MPP4 partial ORF ( NP_149055, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) protein family, with an N-terminal PDZ domain, a central src homology 3 region (SH3), and a C-terminal guanylate kinase-like (GUK) domain. The protein is localized to the outer limiting membrane in the retina, and is thought to function in photoreceptor polarity and the organization of specialized intercellular junctions. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Molecular Mass : 37.73 kDa
AA Sequence : MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPP4 membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4) [ Homo sapiens ]
Official Symbol MPP4
Synonyms MPP4; membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4); DLG6; MAGUK p55 subfamily member 4; discs large homolog 6; discs, large homolog 6; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 5 protein; ALS2CR5;
Gene ID 58538
mRNA Refseq NM_033066
Protein Refseq NP_149055
MIM 606575
UniProt ID Q96JB8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPP4 Products

Required fields are marked with *

My Review for All MPP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon