Recombinant Human MPP6 protein, GST-tagged
Cat.No. : | MPP6-301223H |
Product Overview : | Recombinant Human MPP6 (140-540 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro140-Tyr540 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MPP6 membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) [ Homo sapiens ] |
Official Symbol | MPP6 |
Synonyms | MPP6; membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6); MAGUK p55 subfamily member 6; p55T; PALS2; VAM 1; MAGUK protein p55T; VELI-associated MAGUK 1; protein associated with Lin7 2; VAM1; VAM-1; |
Gene ID | 51678 |
mRNA Refseq | NM_016447 |
Protein Refseq | NP_057531 |
MIM | 606959 |
UniProt ID | Q9NZW5 |
◆ Recombinant Proteins | ||
MPP6-5515H | Recombinant Human MPP6 Protein, GST-tagged | +Inquiry |
Mpp6-681M | Recombinant Mouse Mpp6 protein, His & T7-tagged | +Inquiry |
MPP6-4858H | Recombinant Human MPP6 Protein (Ala331-Tyr503), N-His tagged | +Inquiry |
MPP6-2635R | Recombinant Rhesus Macaque MPP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPP6-301223H | Recombinant Human MPP6 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPP6-4229HCL | Recombinant Human MPP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPP6 Products
Required fields are marked with *
My Review for All MPP6 Products
Required fields are marked with *