Recombinant Human MPP6 protein, GST-tagged
| Cat.No. : | MPP6-301223H |
| Product Overview : | Recombinant Human MPP6 (140-540 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Pro140-Tyr540 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | PLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MPP6 membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) [ Homo sapiens ] |
| Official Symbol | MPP6 |
| Synonyms | MPP6; membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6); MAGUK p55 subfamily member 6; p55T; PALS2; VAM 1; MAGUK protein p55T; VELI-associated MAGUK 1; protein associated with Lin7 2; VAM1; VAM-1; |
| Gene ID | 51678 |
| mRNA Refseq | NM_016447 |
| Protein Refseq | NP_057531 |
| MIM | 606959 |
| UniProt ID | Q9NZW5 |
| ◆ Recombinant Proteins | ||
| MPP6-301223H | Recombinant Human MPP6 protein, GST-tagged | +Inquiry |
| MPP6-2815R | Recombinant Rhesus monkey MPP6 Protein, His-tagged | +Inquiry |
| MPP6-680H | Recombinant Human MPP6 protein, His & T7-tagged | +Inquiry |
| MPP6-2635R | Recombinant Rhesus Macaque MPP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MPP6-508H | Recombinant Human MPP6 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPP6-4229HCL | Recombinant Human MPP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPP6 Products
Required fields are marked with *
My Review for All MPP6 Products
Required fields are marked with *


