Recombinant Human MPPED1 Protein, GST-tagged

Cat.No. : MPPED1-5518H
Product Overview : Human MPPED1 partial ORF ( NP_001576, 34 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MPPED1 (Metallophosphoesterase Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is MPPED2.
Molecular Mass : 35.64 kDa
AA Sequence : AARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPPED1 metallophosphoesterase domain containing 1 [ Homo sapiens ]
Official Symbol MPPED1
Synonyms MPPED1; metallophosphoesterase domain containing 1; C22orf1, chromosome 22 open reading frame 1; metallophosphoesterase domain-containing protein 1; 239AB; FAM1A; adult brain protein 239; C22orf1; FLJ50009; FLJ54633; FLJ59965; FLJ78907; MGC88045;
Gene ID 758
mRNA Refseq NM_001044370
Protein Refseq NP_001037835
MIM 602112
UniProt ID O15442

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPPED1 Products

Required fields are marked with *

My Review for All MPPED1 Products

Required fields are marked with *

0
cart-icon