Recombinant Human MRC2 Protein, His tagged

• Cat.No.: MRC2-001H
• Product Overview: Recombinant Human MRC2 Protein (800-1059 aa) with C-His tag was expressed in Baculovirus-Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 800-1059 aa
• Description: This gene encodes a member of the mannose receptor family of proteins that contain a fibronectin type II domain and multiple C-type lectin-like domains. The encoded protein plays a role in extracellular matrix remodeling by mediating the internalization and lysosomal degradation of collagen ligands. Expression of this gene may play a role in the tumorigenesis and metastasis of several malignancies including breast cancer, gliomas and metastatic bone disease.
• Source: Insect cells
• Species: Human
• Tag: C-His
• Molecular Weight: 32 kDa
• AA Sequence: MCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.5% SKL
• Concentration: 1 mg/mL by Bradford

Gene Information

• Gene Name: MRC2 mannose receptor, C type 2 [ Homo sapiens (human) ]
• Official Symbol: MRC2
• Synonyms: MRC2; mannose receptor, C type 2; C-type mannose receptor 2; CD280; CLEC13E; ENDO180; KIAA0709; endocytic receptor 180; UPAR-associated protein; macrophage mannose receptor 2; C-type lectin domain family 13 member E; endocytic receptor (macrophage mannose receptor family); urokinase-type plasminogen activator receptor-associated protein; UPARAP; FLJ35911
• Gene ID: 9902
• mRNA Refseq: NM_006039
• Protein Refseq: NP_006030
• MIM: 612264
• UniProt ID: Q9UBG0