Recombinant Human MRC2 Protein, His tagged

Cat.No. : MRC2-001H
Product Overview : Recombinant Human MRC2 Protein (800-1059 aa) with C-His tag was expressed in Baculovirus-Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 800-1059 aa
Description : This gene encodes a member of the mannose receptor family of proteins that contain a fibronectin type II domain and multiple C-type lectin-like domains. The encoded protein plays a role in extracellular matrix remodeling by mediating the internalization and lysosomal degradation of collagen ligands. Expression of this gene may play a role in the tumorigenesis and metastasis of several malignancies including breast cancer, gliomas and metastatic bone disease.
Source : Insect cells
Species : Human
Tag : C-His
Molecular Weight : 32 kDa
AA Sequence : MCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.5% SKL
Concentration : 1 mg/mL by Bradford
Gene Name MRC2 mannose receptor, C type 2 [ Homo sapiens (human) ]
Official Symbol MRC2
Synonyms MRC2; mannose receptor, C type 2; C-type mannose receptor 2; CD280; CLEC13E; ENDO180; KIAA0709; endocytic receptor 180; UPAR-associated protein; macrophage mannose receptor 2; C-type lectin domain family 13 member E; endocytic receptor (macrophage mannose receptor family); urokinase-type plasminogen activator receptor-associated protein; UPARAP; FLJ35911
Gene ID 9902
mRNA Refseq NM_006039
Protein Refseq NP_006030
MIM 612264
UniProt ID Q9UBG0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRC2 Products

Required fields are marked with *

My Review for All MRC2 Products

Required fields are marked with *

0
cart-icon