Recombinant Human MRC2 Protein, His tagged
Cat.No. : | MRC2-001H |
Product Overview : | Recombinant Human MRC2 Protein (800-1059 aa) with C-His tag was expressed in Baculovirus-Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 800-1059 aa |
Description : | This gene encodes a member of the mannose receptor family of proteins that contain a fibronectin type II domain and multiple C-type lectin-like domains. The encoded protein plays a role in extracellular matrix remodeling by mediating the internalization and lysosomal degradation of collagen ligands. Expression of this gene may play a role in the tumorigenesis and metastasis of several malignancies including breast cancer, gliomas and metastatic bone disease. |
Source : | Insect cells |
Species : | Human |
Tag : | C-His |
Molecular Weight : | 32 kDa |
AA Sequence : | MCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.5% SKL |
Concentration : | 1 mg/mL by Bradford |
Gene Name | MRC2 mannose receptor, C type 2 [ Homo sapiens (human) ] |
Official Symbol | MRC2 |
Synonyms | MRC2; mannose receptor, C type 2; C-type mannose receptor 2; CD280; CLEC13E; ENDO180; KIAA0709; endocytic receptor 180; UPAR-associated protein; macrophage mannose receptor 2; C-type lectin domain family 13 member E; endocytic receptor (macrophage mannose receptor family); urokinase-type plasminogen activator receptor-associated protein; UPARAP; FLJ35911 |
Gene ID | 9902 |
mRNA Refseq | NM_006039 |
Protein Refseq | NP_006030 |
MIM | 612264 |
UniProt ID | Q9UBG0 |
◆ Recombinant Proteins | ||
MRC2-515HFL | Recombinant Full Length Human MRC2 Protein, C-Flag-tagged | +Inquiry |
MRC2-1133H | Recombinant Human MRC2 | +Inquiry |
Mrc2-4135M | Recombinant Mouse Mrc2 Protein, Myc/DDK-tagged | +Inquiry |
MRC2-29703TH | Recombinant Human MRC2 | +Inquiry |
MRC2-1429H | Recombinant Human MRC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRC2 Products
Required fields are marked with *
My Review for All MRC2 Products
Required fields are marked with *
0
Inquiry Basket