Recombinant Human MREG Protein, GST-tagged

Cat.No. : MREG-4025H
Product Overview : Human DSU full-length ORF ( AAH32747, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MREG (Melanoregulin) is a Protein Coding gene.
Molecular Mass : 49.28 kDa
AA Sequence : MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MREG melanoregulin [ Homo sapiens ]
Official Symbol MREG
Synonyms MREG; melanoregulin; DSU; FLJ10116; WDT2; whn-dependent transcript 2; dilute suppressor protein homolog; MGC90296;
Gene ID 55686
mRNA Refseq NM_018000
Protein Refseq NP_060470
MIM 609207
UniProt ID Q8N565

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MREG Products

Required fields are marked with *

My Review for All MREG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon