Recombinant Human MREG Protein, GST-tagged
| Cat.No. : | MREG-4025H |
| Product Overview : | Human DSU full-length ORF ( AAH32747, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MREG (Melanoregulin) is a Protein Coding gene. |
| Molecular Mass : | 49.28 kDa |
| AA Sequence : | MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MREG melanoregulin [ Homo sapiens ] |
| Official Symbol | MREG |
| Synonyms | MREG; melanoregulin; DSU; FLJ10116; WDT2; whn-dependent transcript 2; dilute suppressor protein homolog; MGC90296; |
| Gene ID | 55686 |
| mRNA Refseq | NM_018000 |
| Protein Refseq | NP_060470 |
| MIM | 609207 |
| UniProt ID | Q8N565 |
| ◆ Recombinant Proteins | ||
| MREG-485H | Recombinant Human melanoregulin, His-tagged | +Inquiry |
| MREG-2643R | Recombinant Rhesus Macaque MREG Protein, His (Fc)-Avi-tagged | +Inquiry |
| MREG-4697HF | Recombinant Full Length Human MREG Protein, GST-tagged | +Inquiry |
| MREG-5086H | Recombinant Human MREG, His-tagged | +Inquiry |
| MREG-5665M | Recombinant Mouse MREG Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MREG-4210HCL | Recombinant Human MREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MREG Products
Required fields are marked with *
My Review for All MREG Products
Required fields are marked with *
