Recombinant Human MREG Protein, GST-tagged
Cat.No. : | MREG-4025H |
Product Overview : | Human DSU full-length ORF ( AAH32747, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MREG (Melanoregulin) is a Protein Coding gene. |
Molecular Mass : | 49.28 kDa |
AA Sequence : | MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MREG melanoregulin [ Homo sapiens ] |
Official Symbol | MREG |
Synonyms | MREG; melanoregulin; DSU; FLJ10116; WDT2; whn-dependent transcript 2; dilute suppressor protein homolog; MGC90296; |
Gene ID | 55686 |
mRNA Refseq | NM_018000 |
Protein Refseq | NP_060470 |
MIM | 609207 |
UniProt ID | Q8N565 |
◆ Recombinant Proteins | ||
MREG-5665M | Recombinant Mouse MREG Protein, His (Fc)-Avi-tagged | +Inquiry |
Mreg-4137M | Recombinant Mouse Mreg Protein, Myc/DDK-tagged | +Inquiry |
MREG-485H | Recombinant Human melanoregulin, His-tagged | +Inquiry |
MREG-5086H | Recombinant Human MREG, His-tagged | +Inquiry |
MREG-2643R | Recombinant Rhesus Macaque MREG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MREG-4210HCL | Recombinant Human MREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MREG Products
Required fields are marked with *
My Review for All MREG Products
Required fields are marked with *
0
Inquiry Basket