Recombinant Human MRO Protein, GST-tagged

Cat.No. : MRO-5551H
Product Overview : Human MRO full-length ORF ( NP_114145.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 55.4 kDa
AA Sequence : MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVFFILAERARDPSAKKRHMAMRNLGTMAYEAPDKVRKYKKIVLDLLVYGLYDPVNLEVIHESMKTLTVVLGKIQGKGLGSFFIDIALQTRTLLDDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRO maestro [ Homo sapiens (human) ]
Official Symbol MRO
Synonyms MRO; maestro; B29; C18orf3; protein maestro; beside the Ma29 deletion; male-specific transcription in the developing reproductive organs
Gene ID 83876
mRNA Refseq NM_001127174
Protein Refseq NP_001120646
MIM 608080
UniProt ID Q9BYG7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRO Products

Required fields are marked with *

My Review for All MRO Products

Required fields are marked with *

0
cart-icon
0
compare icon