Recombinant Human MRPL13 Protein, GST-tagged
Cat.No. : | MRPL13-5557H |
Product Overview : | Human MRPL13 full-length ORF ( AAH09190, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq |
Molecular Mass : | 45.32 kDa |
AA Sequence : | MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL13 mitochondrial ribosomal protein L13 [ Homo sapiens ] |
Official Symbol | MRPL13 |
Synonyms | MRPL13; mitochondrial ribosomal protein L13; 39S ribosomal protein L13, mitochondrial; L13; L13A; L13mt; RPL13; RPML13; MRP-L13; |
Gene ID | 28998 |
mRNA Refseq | NM_014078 |
Protein Refseq | NP_054797 |
MIM | 610200 |
UniProt ID | Q9BYD1 |
◆ Recombinant Proteins | ||
MRPL13-5686M | Recombinant Mouse MRPL13 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL13-4697H | Recombinant Human MRPL13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mrpl13-4148M | Recombinant Mouse Mrpl13 Protein, Myc/DDK-tagged | +Inquiry |
MRPL13-2654R | Recombinant Rhesus Macaque MRPL13 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL13-6381HF | Recombinant Full Length Human MRPL13 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL13-4196HCL | Recombinant Human MRPL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL13 Products
Required fields are marked with *
My Review for All MRPL13 Products
Required fields are marked with *