Recombinant Human MRPL19 Protein, GST-tagged
Cat.No. : | MRPL19-5563H |
Product Overview : | Human MRPL19 full-length ORF ( AAH30144, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq |
Molecular Mass : | 57.86 kDa |
AA Sequence : | MAACIAAGHWAAMGLGRSFQAARTLLPPPASIACRVHAGPVRQQSTGPSEPGAFQPPPKPVIVDKHRPVEPERRFLSPEFIPRRGRTDPLKFQIERKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELRVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKEIEASKRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL19 mitochondrial ribosomal protein L19 [ Homo sapiens ] |
Official Symbol | MRPL19 |
Synonyms | MRPL19; mitochondrial ribosomal protein L19; 39S ribosomal protein L19, mitochondrial; 39S ribosomal protein L19; KIAA0104; MRP L15; RLX1; RPML15; L15mt; 39S ribosomal protein L15, mitochondrial; L19mt; MRPL15; MRP-L15; MRP-L19; MGC20675; |
Gene ID | 9801 |
mRNA Refseq | NM_014763 |
Protein Refseq | NP_055578 |
MIM | 611832 |
UniProt ID | P49406 |
◆ Recombinant Proteins | ||
MRPL19-6392HF | Recombinant Full Length Human MRPL19 Protein, GST-tagged | +Inquiry |
MRPL19-1050H | Recombinant Human MRPL19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MRPL19-5691M | Recombinant Mouse MRPL19 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL19-5563H | Recombinant Human MRPL19 Protein, GST-tagged | +Inquiry |
MRPL19-986H | Recombinant Human MRPL19, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL19-1133HCL | Recombinant Human MRPL19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL19 Products
Required fields are marked with *
My Review for All MRPL19 Products
Required fields are marked with *
0
Inquiry Basket