Recombinant Human MRPL27 Protein, GST-tagged
Cat.No. : | MRPL27-5570H |
Product Overview : | Human MRPL27 full-length ORF ( AAH01066, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq |
Molecular Mass : | 42.02 kDa |
AA Sequence : | MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL27 mitochondrial ribosomal protein L27 [ Homo sapiens (human) ] |
Official Symbol | MRPL27 |
Synonyms | MRPL27; mitochondrial ribosomal protein L27; L27mt; 39S ribosomal protein L27, mitochondrial; MRP-L27; mitochondrial large ribosomal subunit protein bL27m |
Gene ID | 51264 |
mRNA Refseq | NM_016504 |
Protein Refseq | NP_057588 |
MIM | 611837 |
UniProt ID | Q9P0M9 |
◆ Recombinant Proteins | ||
MRPL27-6417HF | Recombinant Full Length Human MRPL27 Protein, GST-tagged | +Inquiry |
MRPL27-5570H | Recombinant Human MRPL27 Protein, GST-tagged | +Inquiry |
MRPL27-2844Z | Recombinant Zebrafish MRPL27 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL27-4183HCL | Recombinant Human MRPL27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL27 Products
Required fields are marked with *
My Review for All MRPL27 Products
Required fields are marked with *