Recombinant Human MRPL32 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MRPL32-2259H |
Product Overview : | MRPL32 MS Standard C13 and N15-labeled recombinant protein (NP_114109) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L32 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome Xp. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MALAMLVLVVSPWSAARGVLRNYWERLLRKLPQSRPGFPSPPWGPALAVQGPAMFTEPANDTSGSKENSSLLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYEKVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRIIERDRKRPSWFTQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MRPL32 mitochondrial ribosomal protein L32 [ Homo sapiens (human) ] |
Official Symbol | MRPL32 |
Synonyms | MRPL32; mitochondrial ribosomal protein L32; L32mt; HSPC283; MRP-L32; bMRP-59b; 39S ribosomal protein L32, mitochondrial; mitochondrial large ribosomal subunit protein bL32m; EC 3.6.5.3 |
Gene ID | 64983 |
mRNA Refseq | NM_031903 |
Protein Refseq | NP_114109 |
MIM | 611839 |
UniProt ID | Q9BYC8 |
◆ Recombinant Proteins | ||
MRPL32-4387Z | Recombinant Zebrafish MRPL32 | +Inquiry |
MRPL32-6446HF | Recombinant Full Length Human MRPL32 Protein, GST-tagged | +Inquiry |
MRPL32-996H | Recombinant Human MRPL32, His-tagged | +Inquiry |
MRPL32-10060M | Recombinant Mouse MRPL32 Protein | +Inquiry |
MRPL32-2259H | Recombinant Human MRPL32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL32 Products
Required fields are marked with *
My Review for All MRPL32 Products
Required fields are marked with *
0
Inquiry Basket