Recombinant Human MRPL4 protein, His-tagged
Cat.No. : | MRPL4-3344H |
Product Overview : | Recombinant Human MRPL4 protein(22 - 154 aa), fused to His tag, was expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22 - 154 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MRPL4 mitochondrial ribosomal protein L4 [ Homo sapiens ] |
Official Symbol | MRPL4 |
Synonyms | MRPL4; mitochondrial ribosomal protein L4; 39S ribosomal protein L4, mitochondrial; CGI 28; MRP-L4; L4mt; CGI-28; MGC2681; MGC16367; |
Gene ID | 51073 |
mRNA Refseq | NM_015956 |
Protein Refseq | NP_057040 |
MIM | 611823 |
UniProt ID | Q9BYD3 |
◆ Recombinant Proteins | ||
MRPL4-5702M | Recombinant Mouse MRPL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL4-3344H | Recombinant Human MRPL4 protein, His-tagged | +Inquiry |
MRPL4-6412HF | Recombinant Full Length Human MRPL4 Protein, GST-tagged | +Inquiry |
MRPL4-2880Z | Recombinant Zebrafish MRPL4 | +Inquiry |
MRPL4-10067M | Recombinant Mouse MRPL4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL4-4171HCL | Recombinant Human MRPL4 293 Cell Lysate | +Inquiry |
MRPL4-4172HCL | Recombinant Human MRPL4 293 Cell Lysate | +Inquiry |
MRPL4-4170HCL | Recombinant Human MRPL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL4 Products
Required fields are marked with *
My Review for All MRPL4 Products
Required fields are marked with *