Recombinant Human MRPL42 protein, GST-tagged
Cat.No. : | MRPL42-3243H |
Product Overview : | Recombinant Human MRPL42 protein(Q9Y6G3)(33-142aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 33-142aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MRPL42 mitochondrial ribosomal protein L42 [ Homo sapiens ] |
Official Symbol | MRPL42 |
Synonyms | MRPL42; mitochondrial ribosomal protein L42; RPML31; MRP-L31; |
Gene ID | 64974 |
◆ Recombinant Proteins | ||
MRPL42-10069M | Recombinant Mouse MRPL42 Protein | +Inquiry |
MRPL42-5703M | Recombinant Mouse MRPL42 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL42-3365H | Recombinant Human MRPL42 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mrpl42-4157M | Recombinant Mouse Mrpl42 Protein, Myc/DDK-tagged | +Inquiry |
MRPL42-3243H | Recombinant Human MRPL42 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL42-4167HCL | Recombinant Human MRPL42 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL42 Products
Required fields are marked with *
My Review for All MRPL42 Products
Required fields are marked with *
0
Inquiry Basket