Recombinant Human MRPL48, His-tagged
Cat.No. : | MRPL48-147H |
Product Overview : | Recombinant Human 39S Ribosomal Protein L48 Mitochondrial/MRPL48 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser29-Lys212) of Human MRPL48 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 29-212 a.a. |
Description : | 39S Ribosomal Protein L48 Mitochondrial(MRPL48) localizes to the mitochondrion. Mitochondrial ribosomes consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, Human MRPL48 consists a 28 amino acid transit peptide and a 184 amino acid mature chain. MRPL48 can interact with OXA1L. |
AA Sequence : | SGEKPIYSVGGILLSISRPYKTKPTHGIGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNI HLTAYDMTLAESYAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHERVVQ ISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEELLAKLKVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MRPL48 mitochondrial ribosomal protein L48 [ Homo sapiens ] |
Official Symbol | MRPL48 |
Synonyms | MRPL48; mitochondrial ribosomal protein L48; 39S ribosomal protein L48, mitochondrial; CGI 118; L48MT; CGI-118; HSPC290; MRP-L48; FLJ17047; FLJ99260; MGC13323; |
Gene ID | 51642 |
mRNA Refseq | NM_016055 |
Protein Refseq | NP_057139 |
MIM | 611853 |
UniProt ID | Q96GC5 |
Chromosome Location | 11q13.4 |
Function | protein binding; structural constituent of ribosome; |
◆ Recombinant Proteins | ||
MRPL48-616H | Recombinant Human mitochondrial ribosomal protein L48, His-tagged | +Inquiry |
MRPL48-147H | Recombinant Human MRPL48, His-tagged | +Inquiry |
MRPL48-1011H | Recombinant Human MRPL48 protein, GST-tagged | +Inquiry |
MRPL48-5591H | Recombinant Human MRPL48 Protein, GST-tagged | +Inquiry |
MRPL48-6432HF | Recombinant Full Length Human MRPL48 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL48-4161HCL | Recombinant Human MRPL48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL48 Products
Required fields are marked with *
My Review for All MRPL48 Products
Required fields are marked with *
0
Inquiry Basket