Recombinant Human MRPL52 Protein, GST-tagged
| Cat.No. : | MRPL52-5596H |
| Product Overview : | Human MRPL52 full-length ORF (AAH68070.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis. [provided by RefSeq |
| Molecular Mass : | 39.93 kDa |
| AA Sequence : | MAALGTVLFTGVRRLHCSAAAWAGGQWRLQQGLAANPSGYGPLTELPDCSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPL52 mitochondrial ribosomal protein L52 [ Homo sapiens ] |
| Official Symbol | MRPL52 |
| Synonyms | MRPL52; mitochondrial ribosomal protein L52 |
| Gene ID | 122704 |
| mRNA Refseq | NM_181307 |
| Protein Refseq | NP_851824 |
| MIM | 611856 |
| UniProt ID | Q86TS9 |
| ◆ Recombinant Proteins | ||
| MRPL52-10079M | Recombinant Mouse MRPL52 Protein | +Inquiry |
| MRPL52-2851R | Recombinant Rhesus monkey MRPL52 Protein, His-tagged | +Inquiry |
| MRPL52-1433H | Recombinant Human MRPL52 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPL52-1015H | Recombinant Human MRPL52, GST-tagged | +Inquiry |
| MRPL52-1797HFL | Recombinant Full Length Human MRPL52 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPL52-4157HCL | Recombinant Human MRPL52 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL52 Products
Required fields are marked with *
My Review for All MRPL52 Products
Required fields are marked with *
