Recombinant Human MRPL54 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MRPL54-4574H
Product Overview : MRPL54 MS Standard C13 and N15-labeled recombinant protein (NP_758455) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.
Molecular Mass : 15.8 kDa
AA Sequence : MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MRPL54 mitochondrial ribosomal protein L54 [ Homo sapiens (human) ]
Official Symbol MRPL54
Synonyms MRPL54; mitochondrial ribosomal protein L54; 39S ribosomal protein L54, mitochondrial; L54mt; MRP-L54;
Gene ID 116541
mRNA Refseq NM_172251
Protein Refseq NP_758455
MIM 611858
UniProt ID Q6P161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL54 Products

Required fields are marked with *

My Review for All MRPL54 Products

Required fields are marked with *

0
cart-icon
0
compare icon