Recombinant Full Length Human MRPL54 Protein, GST-tagged
Cat.No. : | MRPL54-6447HF |
Product Overview : | Human MRPL54 full-length ORF ( NP_758455.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 138 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL54 mitochondrial ribosomal protein L54 [ Homo sapiens ] |
Official Symbol | MRPL54 |
Synonyms | MRPL54; mitochondrial ribosomal protein L54; 39S ribosomal protein L54, mitochondrial; L54mt; MRP-L54; |
Gene ID | 116541 |
mRNA Refseq | NM_172251 |
Protein Refseq | NP_758455 |
MIM | 611858 |
UniProt ID | Q6P161 |
◆ Recombinant Proteins | ||
MRPL54-1016H | Recombinant Human MRPL54, GST-tagged | +Inquiry |
MRPL54-4574H | Recombinant Human MRPL54 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mrpl54-4163M | Recombinant Mouse Mrpl54 Protein, Myc/DDK-tagged | +Inquiry |
MRPL54-5597H | Recombinant Human MRPL54 Protein, GST-tagged | +Inquiry |
MRPL54-6447HF | Recombinant Full Length Human MRPL54 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL54-4155HCL | Recombinant Human MRPL54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL54 Products
Required fields are marked with *
My Review for All MRPL54 Products
Required fields are marked with *