Recombinant Human MRPL55 protein, GST-tagged

• Cat.No.: MRPL55-3245H
• Product Overview: Recombinant Human MRPL55 protein(Q7Z7F7)(34-128aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 34-128aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.6 kDa
• AA Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MRPL55 mitochondrial ribosomal protein L55 [ Homo sapiens ]
• Official Symbol: MRPL55
• Synonyms: MRPL55; mitochondrial ribosomal protein L55; 39S ribosomal protein L55, mitochondrial; L55mt; L55nt; MRP-L55; AAVG5835; PRO19675; MGC61802; DKFZp686D1387
• Gene ID: 128308
• mRNA Refseq: NM_181441
• Protein Refseq: NP_852106
• MIM: 611859
• UniProt ID: Q7Z7F7