Recombinant Human MRPS18B Protein, GST-tagged

Cat.No. : MRPS18B-5607H
Product Overview : Human MRPS18B full-length ORF ( AAH05373, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq
Molecular Mass : 54.12 kDa
AA Sequence : MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPS18B mitochondrial ribosomal protein S18B [ Homo sapiens ]
Official Symbol MRPS18B
Synonyms MRPS18B; mitochondrial ribosomal protein S18B; 28S ribosomal protein S18b, mitochondrial; C6orf14; HSPC183; MRPS18 2; PTD017; S18mt-b; mrps18-b; MRP-S18-b; mitochondrial ribosomal protein S18-2; 28S ribosomal protein S18-2, mitochondrial; S18amt; MRPS18-2; HumanS18a; MRP-S18-2; DKFZp564H0223;
Gene ID 28973
mRNA Refseq NM_014046
Protein Refseq NP_054765
MIM 611982
UniProt ID Q9Y676

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS18B Products

Required fields are marked with *

My Review for All MRPS18B Products

Required fields are marked with *

0
cart-icon
0
compare icon