Recombinant Human MRPS2 Protein, GST-tagged
| Cat.No. : | MRPS2-5608H |
| Product Overview : | Human MRPS2 full-length ORF ( AAH08017, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S2 family. [provided by RefSeq |
| Molecular Mass : | 58.3 kDa |
| AA Sequence : | MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQSSYLIGNMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPS2 mitochondrial ribosomal protein S2 [ Homo sapiens ] |
| Official Symbol | MRPS2 |
| Synonyms | MRPS2; mitochondrial ribosomal protein S2; 28S ribosomal protein S2, mitochondrial; CGI 91; mitochondrial 28S ribosomal protein S2; S2mt; CGI-91; MRP-S2; |
| Gene ID | 51116 |
| mRNA Refseq | NM_016034 |
| Protein Refseq | NP_057118 |
| MIM | 611971 |
| UniProt ID | Q9Y399 |
| ◆ Recombinant Proteins | ||
| MRPS2-5163Z | Recombinant Zebrafish MRPS2 | +Inquiry |
| MRPS2-6479HF | Recombinant Full Length Human MRPS2 Protein, GST-tagged | +Inquiry |
| MRPS2-5608H | Recombinant Human MRPS2 Protein, GST-tagged | +Inquiry |
| MRPS2-2301H | Recombinant Human MRPS2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS2-4146HCL | Recombinant Human MRPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS2 Products
Required fields are marked with *
My Review for All MRPS2 Products
Required fields are marked with *
