Recombinant Human MRPS22 Protein (1-360 aa), GST-tagged

Cat.No. : MRPS22-2148H
Product Overview : Recombinant Human MRPS22 Protein (1-360 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-360 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 68.3 kDa
AA Sequence : MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name MRPS22 mitochondrial ribosomal protein S22 [ Homo sapiens ]
Official Symbol MRPS22
Synonyms MRPS22; C3orf5; GIBT; GK002; MRP S22; S22mt; COXPD5; RPMS22; MRP-S22;
Gene ID 56945
mRNA Refseq NM_020191
Protein Refseq NP_064576
MIM 605810
UniProt ID P82650

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS22 Products

Required fields are marked with *

My Review for All MRPS22 Products

Required fields are marked with *

0
cart-icon