Recombinant Human MRPS22 Protein (1-360 aa), GST-tagged
Cat.No. : | MRPS22-2148H |
Product Overview : | Recombinant Human MRPS22 Protein (1-360 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-360 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 68.3 kDa |
AA Sequence : | MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | MRPS22 mitochondrial ribosomal protein S22 [ Homo sapiens ] |
Official Symbol | MRPS22 |
Synonyms | MRPS22; C3orf5; GIBT; GK002; MRP S22; S22mt; COXPD5; RPMS22; MRP-S22; |
Gene ID | 56945 |
mRNA Refseq | NM_020191 |
Protein Refseq | NP_064576 |
MIM | 605810 |
UniProt ID | P82650 |
◆ Recombinant Proteins | ||
MRPS22-10094M | Recombinant Mouse MRPS22 Protein | +Inquiry |
MRPS22-6484HF | Recombinant Full Length Human MRPS22 Protein, GST-tagged | +Inquiry |
MRPS22-5610H | Recombinant Human MRPS22 Protein, GST-tagged | +Inquiry |
MRPS22-5699Z | Recombinant Zebrafish MRPS22 | +Inquiry |
Mrps22-4169M | Recombinant Mouse Mrps22 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS22-4144HCL | Recombinant Human MRPS22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS22 Products
Required fields are marked with *
My Review for All MRPS22 Products
Required fields are marked with *