Recombinant Human MRPS22 Protein (1-360 aa), GST-tagged

• Cat.No.: MRPS22-2148H
• Product Overview: Recombinant Human MRPS22 Protein (1-360 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-360 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 68.3 kDa
• AA Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: MRPS22 mitochondrial ribosomal protein S22 [ Homo sapiens ]
• Official Symbol: MRPS22
• Synonyms: MRPS22; C3orf5; GIBT; GK002; MRP S22; S22mt; COXPD5; RPMS22; MRP-S22
• Gene ID: 56945
• mRNA Refseq: NM_020191
• Protein Refseq: NP_064576
• MIM: 605810
• UniProt ID: P82650