Recombinant Human MRPS22 Protein, GST-tagged
| Cat.No. : | MRPS22-5610H |
| Product Overview : | Human MRPS22 full-length ORF ( AAH09296, 1 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that does not seem to have a counterpart in prokaryotic and fungal-mitochondrial ribosomes. This gene lies telomeric of and is transcribed in the opposite direction from the forkhead box L2 gene. A pseudogene corresponding to this gene is found on chromosome Xq. [provided by RefSeq |
| Molecular Mass : | 65.34 kDa |
| AA Sequence : | MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPS22 mitochondrial ribosomal protein S22 [ Homo sapiens ] |
| Official Symbol | MRPS22 |
| Synonyms | MRPS22; mitochondrial ribosomal protein S22; 28S ribosomal protein S22, mitochondrial; C3orf5; GIBT; GK002; MRP S22; S22mt; COXPD5; RPMS22; MRP-S22; |
| Gene ID | 56945 |
| mRNA Refseq | NM_020191 |
| Protein Refseq | NP_064576 |
| MIM | 605810 |
| UniProt ID | P82650 |
| ◆ Recombinant Proteins | ||
| Mrps22-4169M | Recombinant Mouse Mrps22 Protein, Myc/DDK-tagged | +Inquiry |
| MRPS22-5699Z | Recombinant Zebrafish MRPS22 | +Inquiry |
| MRPS22-2148H | Recombinant Human MRPS22 Protein (1-360 aa), GST-tagged | +Inquiry |
| MRPS22-10094M | Recombinant Mouse MRPS22 Protein | +Inquiry |
| MRPS22-6484HF | Recombinant Full Length Human MRPS22 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS22-4144HCL | Recombinant Human MRPS22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS22 Products
Required fields are marked with *
My Review for All MRPS22 Products
Required fields are marked with *
