Recombinant Human MRPS23, His-tagged

Cat.No. : MRPS23-28174TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-190 of Human MRPS23 with N terminal His tag; MWt 30kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-190 a.a.
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 7p.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPP LREPVFQRPRVRYGKAKAPIQDIWYHEDRIRAKFYSVY GSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEK LFVETGKALLAEGVILRRVGEARTQHGGSHVSRKSEHL SVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP
Full Length : Full L.
Gene Name MRPS23 mitochondrial ribosomal protein S23 [ Homo sapiens ]
Official Symbol MRPS23
Synonyms MRPS23; mitochondrial ribosomal protein S23; 28S ribosomal protein S23, mitochondrial; CGI 138; HSPC329; MRP S23;
Gene ID 51649
mRNA Refseq NM_016070
Protein Refseq NP_057154
MIM 611985
Uniprot ID Q9Y3D9
Chromosome Location 17q22-q23
Function structural constituent of ribosome;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS23 Products

Required fields are marked with *

My Review for All MRPS23 Products

Required fields are marked with *

0
cart-icon
0
compare icon