Recombinant Human MRPS28 Protein, GST-tagged

Cat.No. : MRPS28-5617H
Product Overview : Human MRPS28 full-length ORF ( NP_054737.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature. [provided by RefSeq
Molecular Mass : 47.2 kDa
AA Sequence : MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPS28 mitochondrial ribosomal protein S28 [ Homo sapiens ]
Official Symbol MRPS28
Synonyms MRPS28; mitochondrial ribosomal protein S28; 28S ribosomal protein S28, mitochondrial; HSPC007; MRP S28; MRPS35; S28mt; S35mt; mitochondrial 28S ribosomal protein S35; 28S ribosomal protein S35, mitochondrial; MRP-S28; MRP-S35; FLJ22853;
Gene ID 28957
mRNA Refseq NM_014018
Protein Refseq NP_054737
MIM 611990
UniProt ID Q9Y2Q9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS28 Products

Required fields are marked with *

My Review for All MRPS28 Products

Required fields are marked with *

0
cart-icon