Recombinant Human MRPS28 Protein, GST-tagged
| Cat.No. : | MRPS28-5617H |
| Product Overview : | Human MRPS28 full-length ORF ( NP_054737.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature. [provided by RefSeq |
| Molecular Mass : | 47.2 kDa |
| AA Sequence : | MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPS28 mitochondrial ribosomal protein S28 [ Homo sapiens ] |
| Official Symbol | MRPS28 |
| Synonyms | MRPS28; mitochondrial ribosomal protein S28; 28S ribosomal protein S28, mitochondrial; HSPC007; MRP S28; MRPS35; S28mt; S35mt; mitochondrial 28S ribosomal protein S35; 28S ribosomal protein S35, mitochondrial; MRP-S28; MRP-S35; FLJ22853; |
| Gene ID | 28957 |
| mRNA Refseq | NM_014018 |
| Protein Refseq | NP_054737 |
| MIM | 611990 |
| UniProt ID | Q9Y2Q9 |
| ◆ Recombinant Proteins | ||
| MRPS28-5617H | Recombinant Human MRPS28 Protein, GST-tagged | +Inquiry |
| Mrps28-4171M | Recombinant Mouse Mrps28 Protein, Myc/DDK-tagged | +Inquiry |
| MRPS28-10099M | Recombinant Mouse MRPS28 Protein | +Inquiry |
| MRPS28-1034H | Recombinant Human MRPS28, GST-tagged | +Inquiry |
| MRPS28-4865Z | Recombinant Zebrafish MRPS28 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS28-4138HCL | Recombinant Human MRPS28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS28 Products
Required fields are marked with *
My Review for All MRPS28 Products
Required fields are marked with *



