Recombinant Human MRPS28 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | MRPS28-105H |
Product Overview : | MRPS28 MS Standard C13 and N15-labeled recombinant protein (NP_054737) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MRPS28 mitochondrial ribosomal protein S28 [ Homo sapiens (human) ] |
Official Symbol | MRPS28 |
Synonyms | MRPS28; mitochondrial ribosomal protein S28; HSPC007; MRP-S28; MRP-S35; MRPS35; 28S ribosomal protein S28, mitochondrial; 28S ribosomal protein S35, mitochondrial; S28mt; S35mt; mitochondrial 28S ribosomal protein S35; mitochondrial small ribosomal subunit protein bS1m |
Gene ID | 28957 |
mRNA Refseq | NM_014018 |
Protein Refseq | NP_054737 |
MIM | 611990 |
UniProt ID | Q9Y2Q9 |
◆ Recombinant Proteins | ||
MRPS28-2864R | Recombinant Rhesus monkey MRPS28 Protein, His-tagged | +Inquiry |
MRPS28-4865Z | Recombinant Zebrafish MRPS28 | +Inquiry |
MRPS28-2684R | Recombinant Rhesus Macaque MRPS28 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS28-6497HF | Recombinant Full Length Human MRPS28 Protein, GST-tagged | +Inquiry |
Mrps28-4171M | Recombinant Mouse Mrps28 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS28-4138HCL | Recombinant Human MRPS28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS28 Products
Required fields are marked with *
My Review for All MRPS28 Products
Required fields are marked with *