Recombinant Human MRPS33 Protein, GST-tagged
| Cat.No. : | MRPS33-5620H |
| Product Overview : | Human MRPS33 full-length ORF ( NP_057155.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that is one of the more highly conserved mitochondrial ribosomal proteins among mammals, Drosophila and C. elegans. Splice variants that differ in the 5 UTR have been found for this gene; all variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q, 4p, 4q, and 20q [provided by RefSeq |
| Molecular Mass : | 39 kDa |
| AA Sequence : | MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPS33 mitochondrial ribosomal protein S33 [ Homo sapiens ] |
| Official Symbol | MRPS33 |
| Synonyms | MRPS33; mitochondrial ribosomal protein S33; 28S ribosomal protein S33, mitochondrial; CGI 139; S33mt; PTD003; CGI-139; MRP-S33; FLJ21123; |
| Gene ID | 51650 |
| mRNA Refseq | NM_016071 |
| Protein Refseq | NP_057155 |
| MIM | 611993 |
| UniProt ID | Q9Y291 |
| ◆ Recombinant Proteins | ||
| Mrps33-4173M | Recombinant Mouse Mrps33 Protein, Myc/DDK-tagged | +Inquiry |
| MRPS33-1037H | Recombinant Human MRPS33, His-tagged | +Inquiry |
| MRPS33-5620H | Recombinant Human MRPS33 Protein, GST-tagged | +Inquiry |
| MRPS33-1110H | Recombinant Human MRPS33 | +Inquiry |
| MRPS33-455Z | Recombinant Zebrafish MRPS33 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS33-4137HCL | Recombinant Human MRPS33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS33 Products
Required fields are marked with *
My Review for All MRPS33 Products
Required fields are marked with *
