Recombinant Human MRPS33 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MRPS33-5115H
Product Overview : MRPS33 MS Standard C13 and N15-labeled recombinant protein (NP_444263) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that is one of the more highly conserved mitochondrial ribosomal proteins among mammals, Drosophila and C. elegans. Splice variants that differ in the 5' UTR have been found for this gene; all variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q, 4p, 4q, and 20q
Molecular Mass : 12.4 kDa
AA Sequence : MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MRPS33 mitochondrial ribosomal protein S33 [ Homo sapiens (human) ]
Official Symbol MRPS33
Synonyms MRPS33; mitochondrial ribosomal protein S33; 28S ribosomal protein S33, mitochondrial; CGI 139; S33mt; PTD003; CGI-139; MRP-S33; FLJ21123;
Gene ID 51650
mRNA Refseq NM_053035
Protein Refseq NP_444263
MIM 611993
UniProt ID Q9Y291

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS33 Products

Required fields are marked with *

My Review for All MRPS33 Products

Required fields are marked with *

0
cart-icon
0
compare icon