Recombinant Human MS4A6A Protein, GST-tagged
Cat.No. : | MS4A6A-5640H |
Product Overview : | Human MS4A6A full-length ORF ( AAH22854, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MS4A6A membrane-spanning 4-domains, subfamily A, member 6A [ Homo sapiens ] |
Official Symbol | MS4A6A |
Synonyms | MS4A6A; membrane-spanning 4-domains, subfamily A, member 6A; MS4A6; membrane-spanning 4-domains subfamily A member 6A; CD20L3; HAIRB-iso; MS4A6A-polymorph; CD20-like precusor; CD20 antigen-like 3; four-span transmembrane protein 3; four-span transmembrane protein 3.1; four-span transmembrane protein 3.2; membrane-spanning 4-domains, subfamily A, member 6A, isoform 2; CDA01; 4SPAN3; MST090; MSTP090; 4SPAN3.2; MGC22650; MGC131944; |
Gene ID | 64231 |
mRNA Refseq | NM_001247999 |
Protein Refseq | NP_001234928 |
MIM | 606548 |
UniProt ID | Q9H2W1 |
◆ Recombinant Proteins | ||
MS4A6A-5640H | Recombinant Human MS4A6A Protein, GST-tagged | +Inquiry |
RFL11098HF | Recombinant Full Length Human Membrane-Spanning 4-Domains Subfamily A Member 6A(Ms4A6A) Protein, His-Tagged | +Inquiry |
MS4A6A-1052H | Recombinant Human MS4A6A, His-tagged | +Inquiry |
MS4A6A-6547HF | Recombinant Full Length Human MS4A6A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A6A-4121HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
MS4A6A-4122HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MS4A6A Products
Required fields are marked with *
My Review for All MS4A6A Products
Required fields are marked with *
0
Inquiry Basket