Recombinant Human MS4A6A Protein, GST-tagged

Cat.No. : MS4A6A-5640H
Product Overview : Human MS4A6A full-length ORF ( AAH22854, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq
Molecular Mass : 52.8 kDa
AA Sequence : MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MS4A6A membrane-spanning 4-domains, subfamily A, member 6A [ Homo sapiens ]
Official Symbol MS4A6A
Synonyms MS4A6A; membrane-spanning 4-domains, subfamily A, member 6A; MS4A6; membrane-spanning 4-domains subfamily A member 6A; CD20L3; HAIRB-iso; MS4A6A-polymorph; CD20-like precusor; CD20 antigen-like 3; four-span transmembrane protein 3; four-span transmembrane protein 3.1; four-span transmembrane protein 3.2; membrane-spanning 4-domains, subfamily A, member 6A, isoform 2; CDA01; 4SPAN3; MST090; MSTP090; 4SPAN3.2; MGC22650; MGC131944;
Gene ID 64231
mRNA Refseq NM_001247999
Protein Refseq NP_001234928
MIM 606548
UniProt ID Q9H2W1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A6A Products

Required fields are marked with *

My Review for All MS4A6A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon